Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

2.50 Rating by CuteStat

tamhaber.com.tr is 1 decade 10 months old. It is a domain having com.tr extension. It has a global traffic rank of #7102027 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, tamhaber.com.tr is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 119
Daily Pageviews: 238

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 827
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 2,360
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 7,102,027
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 16 H2 Headings: 7
H3 Headings: 27 H4 Headings: 1
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 55
Google Adsense: pub-4849172452804768 Google Analytics: UA-11267360-22

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

Sultangazi Petek Temizliği | Bir başka WordPress sitesi

- sultangazipetektemizligi.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 12 Dec 2019 21:34:47 GMT
Server: Apache/2
X-Powered-By: PHP/5.6.40
X-Pingback: http://www.tamhaber.com.tr/xmlrpc.php
Link: <http://www.tamhaber.com.tr/wp-json/>; rel="https://api.w.org/", <http://www.tamhaber.com.tr/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
tamhaber.com.tr A 10797 IP: 77.92.140.32
tamhaber.com.tr NS 14400 Target: ns2.kotuhost.com
tamhaber.com.tr NS 14400 Target: ns1.kotuhost.com
tamhaber.com.tr SOA 10800 MNAME: ns1.kotuhost.com
RNAME: mesutbilgili.outlook.com
Serial: 2019082103
Refresh: 14400
Retry: 3600
Expire: 1209600
Minimum TTL: 86400
tamhaber.com.tr MX 14400 Target: tamhaber.com.tr
tamhaber.com.tr TXT 14400 TXT: v=spf1 a mx ip4:212.68.61.160 ~all

Similarly Ranked Websites

LIVE DRAW SGP | Live Sgp | Widget Result Singapore Pools

- livesgpdraw.net

Live Sgp Draw Met ialah live result angka togel sgp atau lebih dikenal dengan live sgp singapore pools, terbagi menjadi 2 tarikan yaitu live draw sgp 4D dan live draw sgp Toto menjadikan website ini tercepat, terpercaya dan terupdate.

7,102,031 $ 240.00


Home - Avon Grove Charter School

- agcharter.org
7,102,056 $ 240.00

JusticeGhana NewsArchives

- justiceghana.com

JusticeGhana News Archives

7,102,058 $ 240.00

BMW Official Website | BMW Brunei | BMW cars | bmw.com.bn

- bmw.com.bn

The Official BMW Brunei website: BMW automobiles, services, prices, exclusive offers, technologies and all about BMW sheer driving pleasure.

7,102,061 $ 240.00

Full WHOIS Lookup

** Domain Name: tamhaber.com.tr

** Registrant:
-




** Registrar:
NIC Handle : fp39-metu
Organization Name : Ýsim Tescil Ýnternet Teknolojileri A.Þ
Address : Tantavi Mah. Menteþoðlu Cad.
No: 25 Kat: 2 Terra Plaza Ümraniye
Ýstanbul,
Türkiye
Phone : + 90-850-2000444
Fax : + 90-216-6062989


** Domain Servers:
ns1.kotuhost.com
ns2.kotuhost.com

** Additional Info:
Created on..............: 2013-Jun-06.
Expires on..............: 2020-Jun-05.